PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10014716m
Common NameEUTSA_v10014716mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 203aa    MW: 23380.4 Da    PI: 10.3655
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10014716mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.91.3e-28958150
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     k+ienk+ rqvtfskRr g++KKA+ELSvLCda+va +ifs++g+lye++
  Thhalv10014716m  9 KKIENKTSRQVTFSKRRSGLFKKAHELSVLCDAQVAAMIFSQKGRLYEFA 58
                     68***********************************************8 PP

2K-box67.25.8e-23851721198
            K-box  11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                      e+  +  ++e++ + k+ie Lq  +R+l+G++L+ +s+keLq++ ++Leksl  +Rs+K +l+ +++e+l+ ke el++e  +L +++
  Thhalv10014716m  85 EQYVQGIKKEMETMVKKIEVLQAHNRKLMGQSLSFCSVKELQEIATKLEKSLHIVRSRKAKLYEDEVEKLKAKEMELKDERVRLCARI 172
                      56678899************************************************************************99998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.357161IPR002100Transcription factor, MADS-box
SMARTSM004326.5E-40160IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.06E-31378IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-29323IPR002100Transcription factor, MADS-box
CDDcd002651.00E-39375No hitNo description
PfamPF003193.4E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-293859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.40188178IPR002487Transcription factor, K-box
PfamPF014861.3E-2289172IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MVRGKIQIKK IENKTSRQVT FSKRRSGLFK KAHELSVLCD AQVAAMIFSQ KGRLYEFANS  60
DIKKTIKRYA EYKGAYFVAD SKPIEQYVQG IKKEMETMVK KIEVLQAHNR KLMGQSLSFC  120
SVKELQEIAT KLEKSLHIVR SRKAKLYEDE VEKLKAKEME LKDERVRLCA RIGERPMGMP  180
TGSKEKEDVE TDLFIGFPKN RP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S4e-20172172Myocyte-specific enhancer factor 2B
1tqe_R4e-20172172Myocyte-specific enhancer factor 2B
1tqe_Q4e-20172172Myocyte-specific enhancer factor 2B
1tqe_P4e-20172172Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4470610.0DQ447061.1 Arabidopsis thaliana clone pENTR221-At5g51860 MADS-box protein (At5g51860) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006401902.11e-147hypothetical protein EUTSA_v10014716mg
SwissprotQ9FLH51e-122AGL72_ARATH; MADS-box protein AGL72
TrEMBLV4KZF21e-147V4KZF2_EUTSA; Uncharacterized protein
STRINGBra028282.1-P1e-122(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51860.21e-126MIKC_MADS family protein